PDB entry 1b0p

View 1b0p on RCSB PDB site
Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
Class: oxidoreductase
Keywords: oxidoreductase, pyruvate catabolism, iron-sulfur cluster, tpp-dependent enzyme
Deposited on 1998-11-12, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pyruvate-ferredoxin oxidoreductase)
    Species: Desulfovibrio africanus [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b0pa1, d1b0pa2, d1b0pa3, d1b0pa4, d1b0pa5
  • Chain 'B':
    Compound: protein (pyruvate-ferredoxin oxidoreductase)
    Species: Desulfovibrio africanus [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b0pb1, d1b0pb2, d1b0pb3, d1b0pb4, d1b0pb5
  • Heterogens: MG, CA, SF4, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0pA (A:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0pB (B:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk