PDB entry 1b0o

View 1b0o on RCSB PDB site
Description: bovine beta-lactoglobulin complexed with palmitate, lattice z
Class: lipocalin
Keywords: lipocalin, milk whey protein, bovine, palmitate-binding
Deposited on 1998-11-11, released 1999-02-02
The last revision prior to the SCOP 1.73 freeze date was dated 1999-04-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2049
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1b0oa_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0oA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0oA (A:)
    ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
    engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
    lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi