PDB entry 1b0o

View 1b0o on RCSB PDB site
Description: bovine beta-lactoglobulin complexed with palmitate, lattice z
Class: lipocalin
Keywords: lipocalin, milk whey protein, bovine, palmitate-binding
Deposited on 1998-11-11, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b0oa_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0oA (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0oA (A:)
    ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
    engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
    lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi