PDB entry 1b0n

View 1b0n on RCSB PDB site
Description: sinr protein/sini protein complex
Class: transcription regulator
Keywords: transcription regulator, antagonist, sporulation
Deposited on 1998-11-11, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sinr protein)
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SINR, SINI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b0na1, d1b0na2
  • Chain 'B':
    Compound: protein (sini protein)
    Species: Bacillus subtilis [TaxId:1423]
    Gene: SINR, SINI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b0nb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1b0nA (A:)
migqrikqyrkekgyslselaekagvaksylssiernlqtnpsiqflekvsavldvsvht
lldekheteydgqldseweklvrdamtsgvskkqfrefldyqkwrksqkee

    Sequence, based on observed residues (ATOM records): (download) 
    >1b0nA (A:)
migqrikqyrkekgyslselaekagvaksylssiernlqtnpsiqflekvsavldvsvht
lldekhetldseweklvrdamtsgvskkqfrefldyqkwrksq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1b0nB (B:)
mknakqehfeldqewvelmveakeanispeeirkylllnkksahpgpaarshtvnpf

    Sequence, based on observed residues (ATOM records): (download) 
    >1b0nB (B:)
feldqewvelmveakeanispeeirkyllln