PDB entry 1b0l

View 1b0l on RCSB PDB site
Description: recombinant human diferric lactoferrin
Class: metal binding protein
Keywords: transferrin, binding protein, metalloprotein, metal binding protein
Deposited on 1998-11-11, released 1998-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lactoferrin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02788 (0-690)
      • engineered (9)
    Domains in SCOPe 2.07: d1b0la1, d1b0la2
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0lA (A:)
    grrrsvqwctvsqpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtld
    ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
    rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
    cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
    kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
    kdsaigfsrvppridsglylgsgyftaiqnlrkseeevaarrarvvwcavgeqelrkcnq
    wsglsegsvtcssasttedcialvlkgeadamsldggyvytagkcglvpvlaenyksqqs
    sdpdpncvdrpvegylavavvrrsdtsltwnsvkgkkschtavdrtagwnipmgllfnqt
    gsckfdeyfsqscapgsdprsnlcalcigdeqgenkcvpnsneryygytgafrclaenag
    dvafvkdvtvlqntdgnnneawakdlkladfallcldgkrkpvtearschlamapnhavv
    srmdkverlkqvllhqqakfgrngsdcpdkfclfqsetknllfndnteclarlhgkttye
    kylgpqyvagitnlkkcstsplleaceflrk