PDB entry 1b0k

View 1b0k on RCSB PDB site
Description: s642a:fluorocitrate complex of aconitase
Deposited on 1998-11-11, released 1999-11-18
The last revision prior to the SCOP 1.57 freeze date was dated 2000-06-09, with a file datestamp of 2000-06-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0kA (A:)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsaleprhlggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk