PDB entry 1b0k

View 1b0k on RCSB PDB site
Description: s642a:fluorocitrate complex of aconitase
Class: lyase
Keywords: tricarboxylic acid cycle, iron-sulfur, mitochondrion, transit peptide, lyase
Deposited on 1998-11-11, released 1999-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aconitase)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16276 (0-752)
      • engineered (640)
      • conflict (645)
    Domains in SCOPe 2.08: d1b0ka1, d1b0ka2
  • Heterogens: FLC, SF4, O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0kA (A:)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsaleprhlggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk