PDB entry 1b0j

View 1b0j on RCSB PDB site
Description: crystal structure of aconitase with isocitrate
Deposited on 1998-11-10, released 1998-11-18
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.162
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0jA (A:)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegasrehsaleprhlggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk