PDB entry 1b0i

View 1b0i on RCSB PDB site
Description: alpha-amylase from alteromonas haloplanctis
Class: hydrolase
Keywords: alpha-amylase, alpha-1, 4-glucan-4-glucanohydrolase, beta-alpha-eight barrel, psychrophilic enzyme, hydrolase
Deposited on 1998-11-10, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-amylase)
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Gene: AMY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b0ia1, d1b0ia2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0iA (A:)
    tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
    ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
    tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
    asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
    lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
    vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntadnwavtn
    wwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadakscsgev
    itvnsdgtinlnigawdamaihknaklntssas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0iA (A:)
    tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
    ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
    tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
    asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
    lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
    vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntadnwavtn
    wwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadakscsgev
    itvnsdgtinlnigawdamaihknakln