PDB entry 1b0b

View 1b0b on RCSB PDB site
Description: hemoglobin I from the clam lucina pectinata, cyanide complex at 100 kelvin
Class: oxygen storage/transport
Keywords: hemoprotein, sulfide carrier, globins, oxygen transport, oxygen storage/transport complex
Deposited on 1998-11-06, released 2000-02-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.119
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin
  Species: Lucina pectinata [TaxId:29163]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41260 (1-141)
    • see remark 999 (2)
    • conflict (7)
    • see remark 999 (10)
    • see remark 999 (113)
    • see remark 999 (136)
    • see remark 999 (138)
  Domains in SCOPe 2.08: d1b0ba_
• Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b0bA (A:)
  slsaaqkdnvksswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
  maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlagfmksy
  ggdegawtavagalmgmirpdm