PDB entry 1b0a

View 1b0a on RCSB PDB site
Description: 5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
Deposited on 1998-11-06, released 1999-06-29
The last revision prior to the SCOP 1.57 freeze date was dated 1999-06-29, with a file datestamp of 1999-06-28.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.218
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b0aA (A:)
    aakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkaceev
    gfvsrsydlpettseaellelidtlnadntidgilvqlplpagidnvkvlerihpdkdvd
    gfhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmelll
    agctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvv
    gdvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpqde