PDB entry 1b0a

View 1b0a on RCSB PDB site
Description: 5,10, methylene-tetrahydropholate dehydrogenase/cyclohydrolase from e coli.
Class: oxidoreductase,hydrolase
Keywords: folate, dehydrogenase, cyclcohydrolase, bifunctional, channeling, oxidoreductase,hydrolase
Deposited on 1998-11-06, released 1999-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.218
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fold bifunctional protein)
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b0aa1, d1b0aa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b0aA (A:)
    maakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkacee
    vgfvsrsydlpettseaellelidtlnadntidgilvqlplpagidnvkvlerihpdkdv
    dgfhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmell
    lagctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkv
    vgdvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpqde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b0aA (A:)
    aakiidgktiaqqvrsevaqkvqariaaglrapglavvlvgsnpasqiyvaskrkaceev
    gfvsrsydlpettseaellelidtlnadntidgilvqlplpagidnvkvlerihpdkdvd
    gfhpynvgrlcqraprlrpctprgivtllerynidtfglnavvigasnivgrpmsmelll
    agctttvthrftknlrhhvenadllivavgkpgfipgdwikegaividvginrlengkvv
    gdvvfedaakrasyitpvpggvgpmtvatlientlqacveyhdpqde