PDB entry 1b07

View 1b07 on RCSB PDB site
Description: crk sh3 domain complexed with peptoid inhibitor
Class: sh3 domain
Keywords: sh3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction
Deposited on 1998-11-17, released 1999-01-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.242
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (proto-oncogene crk (crk))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1b07a_
  • Chain 'C':
    Compound: protein (sh3 peptoid inhibitor)
    Database cross-references and differences (RAF-indexed):
    • PDB 1B07
  • Heterogens: PYL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b07A (A:)
    gsaeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b07A (A:)
    saeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyh
    

  • Chain 'C':
    No sequence available.