PDB entry 1b06

View 1b06 on RCSB PDB site
Description: superoxide dismutase from sulfolobus acidocaldarius
Class: oxidoreductase
Keywords: superoxide dismutase, oxidoreductase
Deposited on 1998-11-16, released 1999-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08713 (Start-209)
      • conflict (109)
    Domains in SCOPe 2.07: d1b06a1, d1b06a2
  • Chain 'B':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08713 (Start-209)
      • conflict (109)
    Domains in SCOPe 2.07: d1b06b1, d1b06b2
  • Chain 'C':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08713 (Start-209)
      • conflict (109)
    Domains in SCOPe 2.07: d1b06c1, d1b06c2
  • Chain 'D':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08713 (Start-209)
      • conflict (109)
    Domains in SCOPe 2.07: d1b06d1, d1b06d2
  • Chain 'E':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08713 (Start-209)
      • conflict (109)
    Domains in SCOPe 2.07: d1b06e1, d1b06e2
  • Chain 'F':
    Compound: protein (superoxide dismutase)
    Species: Sulfolobus acidocaldarius [TaxId:330779]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08713 (Start-209)
      • conflict (109)
    Domains in SCOPe 2.07: d1b06f1, d1b06f2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b06A (A:)
    tqviqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdl
    pqgqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfk
    qvfsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqy
    knkrgdylnawwnvvnwddaekrlqkylnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b06A (A:)
    viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
    gqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfkqv
    fsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqykn
    krgdylnawwnvvnwddaekrlqkylnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b06B (B:)
    tqviqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdl
    pqgqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfk
    qvfsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqy
    knkrgdylnawwnvvnwddaekrlqkylnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b06B (B:)
    viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
    gqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfkqv
    fsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqykn
    krgdylnawwnvvnwddaekrlqkylnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1b06C (C:)
    tqviqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdl
    pqgqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfk
    qvfsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqy
    knkrgdylnawwnvvnwddaekrlqkylnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b06C (C:)
    viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
    gqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfkqv
    fsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqykn
    krgdylnawwnvvnwddaekrlqkylnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1b06D (D:)
    tqviqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdl
    pqgqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfk
    qvfsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqy
    knkrgdylnawwnvvnwddaekrlqkylnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b06D (D:)
    viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
    gqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfkqv
    fsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqykn
    krgdylnawwnvvnwddaekrlqkylnk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1b06E (E:)
    tqviqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdl
    pqgqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfk
    qvfsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqy
    knkrgdylnawwnvvnwddaekrlqkylnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b06E (E:)
    viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
    gqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfkqv
    fsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqykn
    krgdylnawwnvvnwddaekrlqkylnk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1b06F (F:)
    tqviqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdl
    pqgqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfk
    qvfsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqy
    knkrgdylnawwnvvnwddaekrlqkylnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b06F (F:)
    viqlkryefpqlpykvdalepyiskdiidvhynghhkgyvnganslldrleklikgdlpq
    gqydlqgilrgltfninghklhaiywnnmapagkgggkpggaladlidkqygsfdrfkqv
    fsesanslpgsgwtvlyydnesgnlqimtvenhfmnhiaelpvilivdefehayylqykn
    krgdylnawwnvvnwddaekrlqkylnk