PDB entry 1b05

View 1b05 on RCSB PDB site
Description: Structure of oligo-peptide binding protein complexed with LYS-CYS-LYS
Class: peptide binding protein
Keywords: complex (peptide transport/peptide), peptide transport, peptide binding protein
Deposited on 1998-11-17, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic oligopeptide-binding protein
    Species: Salmonella typhimurium [TaxId:602]
    Gene: OPPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b05a_
  • Chain 'B':
    Compound: peptide lys-cys-lys
    Database cross-references and differences (RAF-indexed):
    • PDB 1B05 (0-2)
  • Heterogens: U1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b05A (A:)
    advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
    aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
    iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
    qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
    idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
    iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
    fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
    neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
    pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh
    

  • Chain 'B':
    No sequence available.