PDB entry 1b04

View 1b04 on RCSB PDB site
Description: structure of the adenylation domain of an nad+ dependent ligase
Class: ligase
Keywords: ligase, DNA replication
Deposited on 1998-11-16, released 1999-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA ligase)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: LIG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87703
      • engineered (113)
    Domains in SCOPe 2.07: d1b04a_
  • Chain 'B':
    Compound: protein (DNA ligase)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: LIG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O87703 (0-End)
      • engineered (113)
    Domains in SCOPe 2.07: d1b04b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b04A (A:)
    mdrqqaerraaelrellnrygyeyyvldrpsvpdaeydrlmqeliaieeqypelktsdsp
    tqriggppleafrkvahrvpmmslanafgegdlrdfdrrvrqevgeaayvcelaidglav
    svryedgyfvqgatrgdgttgeditenlktirslplrlkepvsleargeafmpkasflrl
    neerkargeelfanprnaaagslrqldpkvaasrqldlfvygladaealgiashsealdy
    lqalgfkvnperrrcanideviafvsewhdkrpqlpyeidgivikvdsfaqqralgatak
    sprwaiaykfpaeevvtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b04A (A:)
    drqqaerraaelrellnrygyeyyvldrpsvpdaeydrlmqeliaieeqypelktsdspt
    qriggppleafrkvahrvpmmslanafgegdlrdfdrrvrqevgeaayvcelaidglavs
    vryedgyfvqgatrgdgttgeditenlktirslplrlkepvsleargeafmpkasflrln
    eerkarelfanprnaaagslrqldpkvaasrqldlfvygladaealgiashsealdylqa
    lgfkvnperrrcanideviafvsewhdkrpqlpyeidgivikvdsfaqqralgatakspr
    waiaykfpae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b04B (B:)
    mdrqqaerraaelrellnrygyeyyvldrpsvpdaeydrlmqeliaieeqypelktsdsp
    tqriggppleafrkvahrvpmmslanafgegdlrdfdrrvrqevgeaayvcelaidglav
    svryedgyfvqgatrgdgttgeditenlktirslplrlkepvsleargeafmpkasflrl
    neerkargeelfanprnaaagslrqldpkvaasrqldlfvygladaealgiashsealdy
    lqalgfkvnperrrcanideviafvsewhdkrpqlpyeidgivikvdsfaqqralgatak
    sprwaiaykfpaeevvtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b04B (B:)
    mdrqqaerraaelrellnrygyeyyvldrpsvpdaeydrlmqeliaieeqypelktsdsp
    tqriggppleafrkvahrvpmmslanafgegdlrdfdrrvrqevgeaayvcelaidglav
    svryedgyfvqgatrgdgttgeditenlktirslplrlkepvsleargeafmpkasflrl
    neerkarelfanprnaaagslrqldpkvaasrqldlfvygladaealgiashsealdylq
    algfkvnperrrcanideviafvsewhdkrpqlpyeidgivikvdsfaqqralgataksp
    rwaiaykfpae