PDB entry 1b01

View 1b01 on RCSB PDB site
Description: transcriptional repressor copg/DNA complex
Class: gene regulation/DNA
Keywords: transcriptional repressor, DNA-binding protein, plasmid, protein-DNA complex, gene regulation/DNA
Deposited on 1999-11-15, released 1999-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.247
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional repressor copg
    Species: Streptococcus agalactiae [TaxId:1311]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b01a_
  • Chain 'B':
    Compound: transcriptional repressor copg
    Species: Streptococcus agalactiae [TaxId:1311]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b01b_
  • Chain 'E':
    Compound: DNA (5'-d(*cp*cp*cp*gp*tp*gp*cp*ap*cp*tp*cp*ap*ap*tp*gp*cp*ap*ap*t)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*gp*ap*tp*tp*gp*cp*ap*tp*tp*gp*ap*gp*tp*gp*cp*ap*cp*gp*g)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b01A (A:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b01A (A:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b01B (B:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b01B (B:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.