PDB entry 1b01

View 1b01 on RCSB PDB site
Description: transcriptional repressor copg/dna complex
Deposited on 1999-11-15, released 1999-11-19
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-23, with a file datestamp of 1999-11-22.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.247
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1b01a_
  • Chain 'B':
    Domains in SCOP 1.55: d1b01b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b01A (A:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b01B (B:)
    mkkrltitlsesvlenlekmaremglsksamisvalenykkgq