PDB entry 1b00

View 1b00 on RCSB PDB site
Description: phob receiver domain from escherichia coli
Class: gene regulation
Keywords: transcription factor, phosphate regulation, activation of the pho regulon, alpha/beta doubly wound fold, gene regulation
Deposited on 1998-11-15, released 1999-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.21
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b00a_
  • Chain 'B':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b00b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b00A (A:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrispma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b00A (A:)
    arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsg
    iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr
    ri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b00B (B:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrispma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b00B (B:)
    arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsg
    iqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavmr
    ri