PDB entry 1azz

View 1azz on RCSB PDB site
Description: fiddler crab collagenase complexed to ecotin
Class: complex (serine protease/inhibitor)
Keywords: complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen
Deposited on 1997-11-24, released 1998-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagenase
    Species: Celuca pugilator [TaxId:6772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1azza_
  • Chain 'B':
    Compound: collagenase
    Species: Celuca pugilator [TaxId:6772]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1azzb_
  • Chain 'C':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1azzc_
  • Chain 'D':
    Compound: ecotin
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1azzd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azzA (A:)
    ivggveavpnswphqaalfiddmyfcggslispewiltaahcmdgagfvdvvlgahnire
    deatqvtiqstdftvhenynsfvisndiavirlpvpvtltaaiatvglpstdvgvgtvvt
    ptgwglpsdsalgisdvlrqvdvpimsnadcdavygivtdgnicidstggkgtcngdsgg
    plnyngltygitsfgaaagceagypdaftrvtyfldwiqtqtgitp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azzB (B:)
    ivggveavpnswphqaalfiddmyfcggslispewiltaahcmdgagfvdvvlgahnire
    deatqvtiqstdftvhenynsfvisndiavirlpvpvtltaaiatvglpstdvgvgtvvt
    ptgwglpsdsalgisdvlrqvdvpimsnadcdavygivtdgnicidstggkgtcngdsgg
    plnyngltygitsfgaaagceagypdaftrvtyfldwiqtqtgitp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1azzC (C:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1azzC (C:)
    plekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktle
    gwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvdv
    kyrvwkaeekidnavvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1azzD (D:)
    aesvqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggkle
    nktlegwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytp
    dnvdvkyrvwkaeekidnavvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1azzD (D:)
    qplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenktl
    egwgydyyvfdkvsspvstmmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnvd
    vkyrvwkaeekidnavvr