PDB entry 1azy

View 1azy on RCSB PDB site
Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
Class: glycosyltransferase
Keywords: glycosyltransferase, thymidine phosphorylase, salvage pathway
Deposited on 1997-11-24, released 1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.204
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azyA (A:)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azyB (B:)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise