PDB entry 1azr

View 1azr on RCSB PDB site
Description: crystal structure of pseudomonas aeruginosa zinc azurin mutant asp47asp at 2.4 angstroms resolution
Deposited on 1993-03-04, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1azra_
  • Chain 'B':
    Domains in SCOP 1.55: d1azrb_
  • Chain 'C':
    Domains in SCOP 1.55: d1azrc_
  • Chain 'D':
    Domains in SCOP 1.55: d1azrd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrA (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrB (B:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrC (C:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrD (D:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk