PDB entry 1azr

View 1azr on RCSB PDB site
Description: crystal structure of pseudomonas aeruginosa zinc azurin mutant asp47asp at 2.4 angstroms resolution
Class: electron transfer(cuproprotein)
Keywords: electron transfer(cuproprotein)
Deposited on 1993-03-04, released 1993-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • conflict (46)
    Domains in SCOPe 2.07: d1azra_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • conflict (46)
    Domains in SCOPe 2.07: d1azrb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • conflict (46)
    Domains in SCOPe 2.07: d1azrc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • conflict (1)
      • conflict (46)
    Domains in SCOPe 2.07: d1azrd_
  • Heterogens: CU, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrA (A:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrB (B:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrC (C:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azrD (D:)
    aqcsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghdwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk