PDB entry 1azq

View 1azq on RCSB PDB site
Description: hyperthermophile chromosomal protein sac7d bound with kinked DNA duplex
Class: DNA binding protein/DNA
Keywords: complex (chromatin protein/DNA), DNA-binding, archea, kinked-DNA, minor-groove binding, intercalation, DNA binding protein/DNA complex
Deposited on 1997-11-20, released 1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.186
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (hyperthermophile chromosomal protein sac7d)
  Species: Sulfolobus acidocaldarius [TaxId:2285]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13123 (1-65)
  Domains in SCOPe 2.06: d1azqa_
• Chain 'B':
  Compound: DNA (5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(*gp*tp*ap*ap*tp*tp*ap*c)-3')
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1azqA (A:)
  mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekk
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.