PDB entry 1azp

View 1azp on RCSB PDB site
Description: hyperthermophile chromosomal protein sac7d bound with kinked DNA duplex
Class: DNA binding protein/DNA
Keywords: complex (chromatin protein/DNA), DNA-binding, archea kinked-DNA, minor-groove binding, intercalation
Deposited on 1997-11-19, released 1999-01-13
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hyperthermophile chromosomal protein sac7d)
    Species: Sulfolobus acidocaldarius
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1azpa_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*cp*gp*ap*tp*cp*gp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*ap*tp*cp*gp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azpA (A:)
    mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
    aerekk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.