PDB entry 1azo

View 1azo on RCSB PDB site
Description: DNA mismatch repair protein muth from e. coli
Class: endonuclease
Keywords: endonuclease, muth, DNA repair, hydrolase
Deposited on 1997-11-19, released 1998-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muth
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06722 (Start-231)
      • conflict (131)
      • modified residue (164)
      • modified residue (166)
    Domains in SCOPe 2.07: d1azoa_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1azoA (A:)
    gshmsqprpllsppeteeqllaqaqqlsgytlgelaalvglvtpenlkrdkgwigvllei
    wlgasagskpeqdfaalgvelktipvdslgrplettfvcvapltgnsgvtwetshvrhkl
    krvlwipvegeasiplaqrrvgspllwspneeedrqlredweelmdmivlgqveritarh
    geylqirpkaanakalteaigargeriltlprgfylkknftsallarhfliq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1azoA (A:)
    prpllsppeteeqllaqaqqlsgytlgelaalvglvtpenlkrdkgwigvlleiwlgape
    qdfaalgvelktipvdslgrplettfvcvapltgnsgvtwetshvrhklkrvlwipvege
    asiplaqrrvgspllwspneeedrqlredweelmdmivlgqveritarhgeylqirplte
    aigargeriltlprgfylkknftsallarhfliq