PDB entry 1azi

View 1azi on RCSB PDB site
Description: myoglobin (horse heart) recombinant wild-type complexed with azide
Deposited on 1997-10-11, released 1998-02-25
The last revision prior to the SCOP 1.71 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1azi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1azi_ (-)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg