PDB entry 1aze

View 1aze on RCSB PDB site
Description: nmr structure of the complex between the c32s-y7v mutant of the nsh3 domain of grb2 with a peptide from sos, 10 structures
Class: complex (adaptor protein/peptide)
Keywords: complex (adaptor protein/peptide), sh3 domain, guanine-nucleotide releasing factor
Deposited on 1997-11-17, released 1999-05-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: grb2
  Species: Homo sapiens [TaxId:9606]
  Gene: GRB2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62993 (0-55)
    • engineered (6)
    • engineered (31)
  Domains in SCOPe 2.02: d1azea_
• Chain 'B':
  Compound: sos
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26675 (0-8)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1azeA (A:)
  meaiakvdfkataddelsfkrgdilkvlneesdqnwykaelngkdgfipknyiemk
  

  
  
• Chain 'B':
  No sequence available.