PDB entry 1aze

View 1aze on RCSB PDB site
Description: nmr structure of the complex between the c32s-y7v mutant of the nsh3 domain of grb2 with a peptide from sos, 10 structures
Class: complex (adaptor protein/peptide)
Keywords: complex (adaptor protein/peptide), sh3 domain, guanine-nucleotide releasing factor
Deposited on 1997-11-17, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: grb2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62993 (0-55)
      • engineered (6)
      • engineered (31)
    Domains in SCOPe 2.08: d1azea_
  • Chain 'B':
    Compound: sos
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azeA (A:)
    meaiakvdfkataddelsfkrgdilkvlneesdqnwykaelngkdgfipknyiemk
    

  • Chain 'B':
    No sequence available.