PDB entry 1azd

View 1azd on RCSB PDB site
Description: concanavalin from canavalia brasiliensis
Class: lectin
Keywords: legume lectin
Deposited on 1997-11-16, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.16
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conbr
    Species: Canavalia brasiliensis [TaxId:61861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azda_
  • Chain 'B':
    Compound: conbr
    Species: Canavalia brasiliensis [TaxId:61861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azdb_
  • Chain 'C':
    Compound: conbr
    Species: Canavalia brasiliensis [TaxId:61861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azdc_
  • Chain 'D':
    Compound: conbr
    Species: Canavalia brasiliensis [TaxId:61861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azdd_
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azdA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azdB (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azdC (C:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azdD (D:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan