PDB entry 1azc

View 1azc on RCSB PDB site
Description: structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Deposited on 1992-12-16, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1azca_
  • Chain 'B':
    Domains in SCOP 1.55: d1azcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azcA (A:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    mkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1azcB (B:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    mkgtlklsn