PDB entry 1aza

View 1aza on RCSB PDB site
Description: structure of azurin from alcaligenes $denitrificans at 2.5 angstroms resolution
Deposited on 1984-05-07, released 1984-07-18
The last revision was dated 1987-01-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1azaA (A:)
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksvmghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1azaB (B:)
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksvmghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn