PDB entry 1az5

View 1az5 on RCSB PDB site
Description: unliganded siv protease structure in an "open" conformation
Deposited on 1997-11-25, released 1998-05-27
The last revision prior to the SCOP 1.63 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1az5__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1az5_ (-)
    pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1az5_ (-)
    pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivgfintkeyknvev
    evlgkrikgtimtgdtpinifgrnlltalgmslnf