PDB entry 1az5

View 1az5 on RCSB PDB site
Description: unliganded siv protease structure in an "open" conformation
Class: aspartyl protease
Keywords: hiv, aids, proteinase, aspartyl protease, endonuclease
Deposited on 1997-11-25, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: SIV(MAC)239
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05896 (0-97)
      • engineered (3)
      • conflict (6)
      • conflict (63)
    Domains in SCOPe 2.08: d1az5a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1az5A (A:)
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf

    Sequence, based on observed residues (ATOM records): (download) 
    >1az5A (A:)
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivgfintkeyknvev
evlgkrikgtimtgdtpinifgrnlltalgmslnf