PDB entry 1az3

View 1az3 on RCSB PDB site
Description: ecorv endonuclease, unliganded, form b
Class: endonuclease
Keywords: endonuclease
Deposited on 1997-11-24, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ecorv endonuclease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1az3a_
  • Chain 'B':
    Compound: ecorv endonuclease
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1az3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1az3A (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1az3A (A:)
    slrsdlinydvcgiisaegkiyplstifelfsrpiinkiaekhgyiveepkqqnhypdft
    lykpsepnkkiaidikttytenekkftlggytsfirnntknivypfdqyiahwiigyvyt
    rvktyninelneipkpykgvkvflqdkwviagdlagnigsihahykdfvegkgifdsede
    fldywr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1az3B (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1az3B (B:)
    slrsdlinalydedvcgiisaegkiyplgsdkvlstifelfsrpiinkiaekhgyiveep
    kqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntknivypfd
    qyiahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagnigsihahykd
    fvegkgifdsedefldywrnyekynniseyrnwiy