PDB entry 1az1

View 1az1 on RCSB PDB site
Description: alrestatin bound to c298a/w219y mutant human aldose reductase
Class: oxidoreductase
Keywords: oxidoreductase, aldo-keto reductase, inhibitor binding
Deposited on 1997-11-24, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (Start-314)
      • engineered (218)
      • engineered (297)
    Domains in SCOPe 2.07: d1az1a_
  • Heterogens: NAP, ALR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1az1A (A:)
    asrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqe
    klreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgke
    ffpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpa
    vnqiechpyltqekliqycqskgivvtaysplgspdrpyakpedpslledprikaiaakh
    nkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvaal
    lsctshkdypfheef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1az1A (A:)
    srlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqek
    lreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgkef
    fpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpav
    nqiechpyltqekliqycqskgivvtaysplgspdrpyakpedpslledprikaiaakhn
    kttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvaall
    sctshkdypfheef