PDB entry 1az0

View 1az0 on RCSB PDB site
Description: ecorv endonuclease/DNA complex
Class: hydrolase/DNA
Keywords: protein-DNA complex, ecorv endonuclease-DNA complex, hydrolase/DNA complex
Deposited on 1997-11-24, released 1998-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (type II restriction enzyme ecorv)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1az0a_
  • Chain 'B':
    Compound: protein (type II restriction enzyme ecorv)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1az0b_
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*tp*ap*tp*cp*tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*tp*ap*tp*cp*tp*t)-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1az0A (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1az0A (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagsgnttn
    igsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1az0B (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1az0B (B:)
    slrsdlinalydedvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyivee
    pkqqnhypdftlykpsepnkkiaidikttytnikftlggytsfirnntknivypfdqyia
    hwiigyvytrvslktynielneipkpykgvkvflqdkwviagdlagsgnttnigsihahy
    kdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.