PDB entry 1ayz

View 1ayz on RCSB PDB site
Description: crystal structure of the saccharomyces cerevisiae ubiquitin-conjugating enzyme rad6 (ubc2) at 2.6a resolution
Class: ubiquitin conjugation
Keywords: ubiquitin conjugation, ubiquitin-conjugating enzyme
Deposited on 1997-11-12, released 1998-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme rad6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ayza_
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme rad6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ayzb_
  • Chain 'C':
    Compound: ubiquitin-conjugating enzyme rad6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ayzc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ayzA (A:)
    mstparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefd
    eeypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpas
    panveaatlfkdhksqyvkrvketveksweddmdddddddddddddead
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayzA (A:)
    stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
    eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
    anveaatlfkdhksqyvkrvketveksweddmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ayzB (B:)
    mstparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefd
    eeypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpas
    panveaatlfkdhksqyvkrvketveksweddmdddddddddddddead
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayzB (B:)
    stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
    eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
    anveaatlfkdhksqyvkrvketveksweddmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ayzC (C:)
    mstparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefd
    eeypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpas
    panveaatlfkdhksqyvkrvketveksweddmdddddddddddddead
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayzC (C:)
    stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
    eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
    anveaatlfkdhksqyvkrvketveksweddmd