PDB entry 1ayy

View 1ayy on RCSB PDB site
Description: glycosylasparaginase
Class: hydrolase
Keywords: glycoamidase, signal, hydrolase
Deposited on 1997-11-12, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.188
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosylasparaginase
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayy.1
  • Chain 'B':
    Compound: glycosylasparaginase
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayy.1
  • Chain 'C':
    Compound: glycosylasparaginase
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayy.2
  • Chain 'D':
    Compound: glycosylasparaginase
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayy.2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ayyA (A:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayyA (A:)
    tnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdg
    rvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkke
    nlltaesekewkewlkts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ayyB (B:)
    tigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdneigaatatghgeevir
    tvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkgeygayci
    qdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayyB (B:)
    tigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdneigaatatghgeevir
    tvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkgeygayci
    qdgfnfavhdqkgnrletpgfal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ayyC (C:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayyC (C:)
    tnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdg
    rvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkke
    nlltaesekewkewlktsqy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayyD (D:)
    tigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdneigaatatghgeevir
    tvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkgeygayci
    qdgfnfavhdqkgnrletpgfalk