PDB entry 1ayw

View 1ayw on RCSB PDB site
Description: crystal structure of cysteine protease human cathepsin k in complex with a covalent benzyloxybenzoylcarbohydrazide inhibitor
Class: hydrolase
Keywords: hydrolase, sulfhydryl proteinase
Deposited on 1997-11-10, released 1998-11-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.237
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1aywa_
  • Heterogens: IN3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aywA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm