PDB entry 1ayq

View 1ayq on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase from the moderate facultative thermophile, bacillus coagulans
Class: oxidoreductase
Keywords: oxidoreductase, 3-isopropylmalate dehydrogenase, leucine biosynthesis, moderate thermophile
Deposited on 1997-11-07, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 1998-01-28, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.18
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus coagulans
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayqa_
  • Chain 'B':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Bacillus coagulans
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ayqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ayqA (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ayqA (A:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrliekln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayqB (B:)
    mkmklavlpgdgigpevmdaairvlktvldndgheavfenaliggaaideagtplpeetl
    dicrrsdaillgavggpkwdhnpaslrpekgllglrkemglfanlrpvkayatllnaspl
    krervenvdlvivreltgglyfgrpserrgpgenevvdtlaytreeieriiekafqlaqi
    rrkklasvdkanvlessrmwreiaeetakkypdvelshmlvdstsmqlianpgqfdvivt
    enmfgdilsdeasvitgslgmlpsaslrsdrfgmyepvhgsapdiagqgkanplgtvlsa
    almlrysfglekeaaaiekavddvlqdgyctgdlqvangkvvstieltdrlieklnn