PDB entry 1ayo

View 1ayo on RCSB PDB site
Description: receptor binding domain of bovine alpha-2-macroglobulin
Class: macroglobulin
Keywords: macroglobulin, receptor binding domain
Deposited on 1997-11-07, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-2-macroglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01023 (0-129)
      • conflict (6)
      • conflict (16)
      • conflict (32)
      • conflict (36)
      • conflict (73)
      • conflict (84)
      • conflict (86)
      • conflict (89)
      • conflict (91)
      • conflict (98)
      • conflict (121)
      • conflict (125)
    Domains in SCOPe 2.07: d1ayoa_
  • Chain 'B':
    Compound: alpha-2-macroglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01023 (0-129)
      • conflict (6)
      • conflict (16)
      • conflict (32)
      • conflict (36)
      • conflict (73)
      • conflict (84)
      • conflict (86)
      • conflict (89)
      • conflict (91)
      • conflict (98)
      • conflict (121)
      • conflict (125)
    Domains in SCOPe 2.07: d1ayob_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayoA (A:)
    efpfalevqtlpqtcdgpkahtsfqislsvsyigsrpasnmaivdvkmvsgfiplkptvk
    mlersnvsrtevsnnhvliyldkvtnetltltftvlqdipvrdlkpaivkvydyyetdef
    avaeysapcs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayoB (B:)
    efpfalevqtlpqtcdgpkahtsfqislsvsyigsrpasnmaivdvkmvsgfiplkptvk
    mlersnvsrtevsnnhvliyldkvtnetltltftvlqdipvrdlkpaivkvydyyetdef
    avaeysapcs