PDB entry 1ayk

View 1ayk on RCSB PDB site
Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, 30 structures
Class: metalloprotease
Keywords: matrix metalloprotease, hydrolase, metalloprotease, glycoprotein
Deposited on 1997-11-06, released 1998-02-25
The last revision prior to the SCOP 1.73 freeze date was dated 1998-02-25, with a file datestamp of 2007-06-04.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ayka_
  • Heterogens: ZN, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1aykA (A:)
vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp