PDB entry 1ayk

View 1ayk on RCSB PDB site
Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, 30 structures
Deposited on 1997-11-06, released 1998-02-25
The last revision prior to the SCOP 1.61 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1ayk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayk_ (-)
    vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp