PDB entry 1ayj

View 1ayj on RCSB PDB site
Description: determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures
Class: fungicide
Keywords: fungicide, plant defensin, cysteine-stabilized alfa/beta motif
Deposited on 1997-11-05, released 1998-01-28
The last revision prior to the SCOP 1.75 freeze date was dated 1998-01-28, with a file datestamp of 2007-06-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antifungal protein 1
    Species: Raphanus sativus var. niger
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ayja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayjA (A:)
    eklcerpsgtwsgvcgnnnacknqcinlekarhgscnyvfpahkcicyfpc