PDB entry 1ayj

View 1ayj on RCSB PDB site
Description: determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures
Class: fungicide
Keywords: fungicide, plant defensin, cysteine-stabilized alfa/beta motif
Deposited on 1997-11-05, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antifungal protein 1
  Species: Raphanus sativus var. niger [TaxId:41679]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P30231 (1-50)
  Domains in SCOPe 2.08: d1ayja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ayjA (A:)
  eklcerpsgtwsgvcgnnnacknqcinlekarhgscnyvfpahkcicyfpc