PDB entry 1ayi

View 1ayi on RCSB PDB site
Description: colicin e7 immunity protein im7
Deposited on 1997-11-04, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ayi__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayi_ (-)
    melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
    rddspegivkeikewraangkpgfkq