PDB entry 1ayg

View 1ayg on RCSB PDB site
Description: solution structure of cytochrome c-552, nmr, 20 structures
Class: electron transport
Keywords: cytochrome c, electron transport, porphyrin, ferrous iron
Deposited on 1997-11-04, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c-552
    Species: Hydrogenobacter thermophilus [TaxId:940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ayga_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aygA (A:)
    neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
    pqnvtdaeakqlaqwilsik