PDB entry 1ayf

View 1ayf on RCSB PDB site
Description: bovine adrenodoxin (oxidized)
Deposited on 1997-11-03, released 1998-12-30
The last revision prior to the SCOP 1.63 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ayfa_
  • Chain 'B':
    Domains in SCOP 1.63: d1ayfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ayfA (A:)
kitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhife
kleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ayfB (B:)
dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp