PDB entry 1aye

View 1aye on RCSB PDB site
Description: human procarboxypeptidase a2
Class: serine protease
Keywords: serine protease, zymogen, hydrolase
Deposited on 1997-11-03, released 1999-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procarboxypeptidase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ayea1, d1ayea2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ayeA (A:)
    letfvgdqvleivpsneeqiknllqleaqehlqldfwkspttpgetahvrvpfvnvqavk
    vflesqgiaysimiedvqvlldkeneemlfnrrrersgnfnfgayhtleeisqemdnlva
    ehpglvskvnigssfenrpmnvlkfstggdkpaiwldagiharewvtqatalwtankivs
    dygkdpsitsildaldifllpvtnpdgyvfsqtknrmwrktrskvsgslcvgvdpnrnwd
    agfggpgassnpcsdsyhgpsansevevksivdfikshgkvkafiilhsysqllmfpygy
    kctklddfdelsevaqkaaqslrslhgtkykvgpicsviyqasggsidwsydygikysfa
    felrdtgrygfllparqilptaeetwlglkaimehvrdhpy